PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 263aa    MW: 28663.8 Da    PI: 5.5623
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30142.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.4e-1192139552
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                 k e+r   NReA r++R++Kka+ + Le++v+ L a N++L k+l++ 
  KFK30142.1  92 KGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQSH 139
                 6799999***********************************999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-1188155IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86490156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-1391156No hitNo description
PfamPF077161.2E-1492145IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-792140No hitNo description
CDDcd146867.55E-1394147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEDGELDFSN QEVFSSSDMG ELPPSNCSMD SFFDGLLMDS HQAACTHTHT CNPTGPENTH  60
THTCFHVHTK ILPDESDEKV STDDTAESCG KKGEKRPLGN REAVRKYREK KKAKAASLED  120
EVARLRAVNQ QLVKRLQSHA TLEAEVSRLK CLLVDLRGRI DGEIGAFPYQ KPMATANIPS  180
FSHMMNPCNV ECDDDVYCLQ DGFGGNSQEG AAINDQGLSG CEFDQLQCIA NQNLGANGNG  240
SFNNANASVS NKRKGGHRAP KAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412160.10.0hypothetical protein EUTSA_v10026007mg
SwissprotQ8VY761e-172BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A087GJU00.0A0A087GJU0_ARAAL; Uncharacterized protein
STRINGAT4G35040.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-160bZIP family protein